PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA5G00069
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 338aa    MW: 38172.3 Da    PI: 7.0697
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA5G00069genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.47.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g++R+ k+c++rw +yl
        AA5G00069 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLRRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding49.78.6e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T+ E++ +v++ ++lG++ W++Ia++++  Rt++++k++w+++l
        AA5G00069  67 RGNFTEHEEKMIVHLQALLGNR-WAAIASYLP-ERTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129426.152965IPR017930Myb domain
SuperFamilySSF466891.44E-3011108IPR009057Homeodomain-like
SMARTSM007171.0E-141363IPR001005SANT/Myb domain
PfamPF002491.7E-161461IPR001005SANT/Myb domain
CDDcd001675.82E-111661No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2465117IPR009057Homeodomain-like
SMARTSM007177.7E-1666114IPR001005SANT/Myb domain
PROSITE profilePS5129419.41266116IPR017930Myb domain
PfamPF002494.6E-1467112IPR001005SANT/Myb domain
CDDcd001675.94E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0010468Biological Processregulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MGRPPCCEKI GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLRRCS KSCRLRWTNY  60
LRPGIKRGNF TEHEEKMIVH LQALLGNRWA AIASYLPERT DNDIKNYWNT HLKKKLKKIN  120
EFGENNNNGF TSSNTSSHKQ HQNSNKGQWE RRLQTDINMA KQALCEALSL DKPSSSSSTP  180
TSHKNTNFSS LFDQHFDPSS SSSSTTTSDT NPYSSGVYAS SAQNIARLLQ DFMKDTPKSI  240
TLTSSSVSET EQVPETGRVI VSSPSTTEEG FEQSFFSFNS MEKPQNFHEI ETKPTIATVH  300
DNHDHDHHGL ISQGSLSLLE KWLFDEQSHD MIGMSLDY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-251411627128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00579DAPTransfer from AT5G62470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010483959.11e-174PREDICTED: myb-related protein 306-like
SwissprotP813921e-116MYB06_ANTMA; Myb-related protein 306
TrEMBLE4MXC01e-172E4MXC0_EUTHA; mRNA, clone: RTFL01-26-J10
TrEMBLV4KWE51e-172V4KWE5_EUTSA; Uncharacterized protein
STRINGAT5G62470.21e-171(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62470.21e-158myb domain protein 96